PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0072869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NZZ/SPL
Protein Properties Length: 96aa    MW: 10298.2 Da    PI: 10.3161
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0072869.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE20.57.9e-0724734695
           NOZZLE 46 kpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaai 95
                     + g    + kq+k   rg+gva+le+ ++ee+ k+ v  t   +ss ++ 
  Lj0g3v0072869.1 24 NNGRSLKKAKQRKVPQRGLGVAQLEKIRLEEQEKRDVNGTPISSSSSSTK 73
                     456666788999999***************99888877665555544333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087445.1E-52573IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MEEDQEDIPR SYSNGGGSGG GGGNNGRSLK KAKQRKVPQR GLGVAQLEKI RLEEQEKRDV  60
NGTPISSSSS STKSSYLNNF HHSSSTTTTP LPTRPP
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj0g3v0072869.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027342643.19e-19uncharacterized protein LOC113855272
TrEMBLA0A445HU399e-17A0A445HU39_GLYSO; Uncharacterized protein
TrEMBLK7LWF89e-17K7LWF8_SOYBN; SPOROCYTELESS-like EAR-containing protein
STRINGGLYMA12G35701.11e-17(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89561213