PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.1878s0002.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 72aa MW: 8346.5 Da PI: 8.4901 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 26.1 | 1.7e-08 | 8 | 37 | 29 | 58 |
STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 29 sagCpvkkkversaedpkvveitYegeHnh 58 +++C vkk+ve +dp++v++tYe +Hn Kalax.1878s0002.2.p 8 TQQCIVKKRVEGLFQDPSTVITTYERQHNN 37 579*************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 10.005 | 1 | 40 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.5E-7 | 7 | 38 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.66E-6 | 8 | 38 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MICYGYMTQQ CIVKKRVEGL FQDPSTVITT YERQHNNHCQ ATLRGNVFID LSSYTKQKST 60 HEKPEETRHL I* |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027063441.1 | 9e-14 | WRKY transcription factor 71-like |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29860.1 | 3e-12 | WRKY DNA-binding protein 71 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.1878s0002.2.p |