PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.1490s0003.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 111aa MW: 13051.2 Da PI: 11.5081 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.4 | 2.9e-17 | 22 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+ +l Kalax.1490s0003.1.p 22 RGNMSEDEEDLIKRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNLHL 67 89********************.*********.***********9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 7.559 | 1 | 16 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.45E-21 | 2 | 72 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.6E-10 | 2 | 28 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.364 | 17 | 71 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-16 | 21 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-15 | 22 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.11E-11 | 24 | 67 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-20 | 29 | 68 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
LNRSGKSCRL RWLNYLKPGI KRGNMSEDEE DLIKRLHKLL GNRWSLIAGR LPGRTDNEIK 60 NYWNLHLKKR VLGERENLNT RLEPAIMRRN QLPTAITIMN AMQETQMRTR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-20 | 3 | 71 | 40 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022732259.1 | 5e-40 | transcription factor MYB114-like | ||||
Swissprot | Q38850 | 6e-35 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | A0A061GJG6 | 3e-38 | A0A061GJG6_THECC; Myb domain protein 5 isoform 2 | ||||
TrEMBL | A0A061GSC7 | 3e-38 | A0A061GSC7_THECC; Myb domain protein 5 isoform 1 | ||||
TrEMBL | A0A4D6Q5I0 | 4e-38 | A0A4D6Q5I0_9ASPA; Transcription factor | ||||
TrEMBL | A0A4D6QCQ2 | 4e-38 | A0A4D6QCQ2_9ASPA; Transcription factor | ||||
STRING | EOY30035 | 4e-39 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 2e-37 | myb domain protein 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.1490s0003.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|