PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.1326s0008.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 128aa MW: 14261 Da PI: 10.1338 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 93.3 | 3e-29 | 50 | 106 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq R k+e+e+kl +ksrk+ylheSRh hAlrR+Rg+ G F Kalax.1326s0008.1.p 50 EEPVFVNAKQYHGILRRRQPRGKAESENKL-AKSRKQYLHESRHPHALRRARGCAGCF 106 69****************************.***********************9977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-31 | 48 | 109 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 33.237 | 49 | 109 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 9.7E-25 | 51 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 6.6E-20 | 52 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 6.6E-20 | 83 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
HNPYYRSIFT SHEAPPYSAQ PYSPQPMVCP HAAYVGIQQA GLPLPSDVVE EPVFVNAKQY 60 HGILRRRQPR GKAESENKLA KSRKQYLHES RHPHALRRAR GCAGCFLNAK KNENNQKNES 120 TSGGSSH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-19 | 49 | 114 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021903689.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_021903693.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
Refseq | XP_021903694.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
Refseq | XP_021903695.1 | 2e-56 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
Swissprot | Q84JP1 | 2e-44 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | B9SB33 | 2e-54 | B9SB33_RICCO; Nuclear transcription factor Y subunit A-4, putative | ||||
STRING | evm.model.supercontig_20.45 | 2e-56 | (Carica papaya) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.1 | 8e-39 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.1326s0008.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|