PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.1055s0009.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 165aa MW: 18361.6 Da PI: 6.9226 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 157.7 | 1.9e-49 | 33 | 128 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 +eqd++lPianv+rimk++lP nakisk+aket+qecvsefisfvt++as+kc++ekrkt+ngdd++wal++lGf+dy+ + k yl++yr Kalax.1055s0009.1.p 33 KEQDHLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGDASHKCRKEKRKTLNGDDICWALGSLGFDDYAYATKRYLRRYR 122 79**************************************************************************************** PP NF-YB 92 elegek 97 +le+e+ Kalax.1055s0009.1.p 123 DLESER 128 ***987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-47 | 29 | 143 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.08E-35 | 35 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.1E-26 | 39 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-14 | 66 | 84 | No hit | No description |
PRINTS | PR00615 | 1.4E-14 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 1.4E-14 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MADNTGSNVS ECSLKHTHEA ESSGTANREG VLKEQDHLLP IANVGRIMKQ ILPPNAKISK 60 EAKETMQECV SEFISFVTGD ASHKCRKEKR KTLNGDDICW ALGSLGFDDY AYATKRYLRR 120 YRDLESERAD QNRVGNNEQK DMEPPRNNPV AVSGTITSTI NFIL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-42 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-42 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023891930.1 | 2e-67 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O82248 | 4e-53 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2N9ECM2 | 5e-65 | A0A2N9ECM2_FAGSY; Uncharacterized protein | ||||
STRING | GLYMA10G02480.1 | 3e-64 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-55 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.1055s0009.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|