PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.1021s0008.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 132aa MW: 14741.7 Da PI: 10.1466 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.9 | 2.2e-41 | 50 | 126 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqve+C+ad+s+ak+yhrrhkvCe+h+k + ++v+gl+qrfCqqCsrfh +sefDe krsCrrrLa+hn+rrrk+++ Kalax.1021s0008.2.p 50 CQVENCTADMSDAKQYHRRHKVCEFHAKVQIAVVAGLQQRFCQQCSRFHLVSEFDEFKRSCRRRLAGHNQRRRKNTH 126 **************************************************************************875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.4E-32 | 46 | 111 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.616 | 47 | 124 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.11E-37 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.6E-30 | 50 | 123 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MRPGECAYGK GSVSGPTGHD TVRSSSSSTG WTPVPQHQLP PRNPQPLSLC QVENCTADMS 60 DAKQYHRRHK VCEFHAKVQI AVVAGLQQRF CQQCSRFHLV SEFDEFKRSC RRRLAGHNQR 120 RRKNTHACPA G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-36 | 47 | 123 | 8 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010057392.1 | 2e-42 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Refseq | XP_021291050.1 | 5e-42 | squamosa promoter-binding protein 1-like isoform X1 | ||||
Swissprot | Q38741 | 5e-39 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A059C8J5 | 4e-41 | A0A059C8J5_EUCGR; Squamosa promoter-binding-like protein | ||||
STRING | XP_010057392.1 | 6e-42 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 7e-41 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.1021s0008.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|