PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0637s0007.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 177aa MW: 19022.2 Da PI: 6.1196 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.6 | 6.8e-57 | 27 | 124 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisfvtseasdkc +ekrkt+ngddllwa++tlGfedy++pl++yl++y Kalax.0637s0007.3.p 27 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFVTSEASDKCLKEKRKTVNGDDLLWAMGTLGFEDYIDPLRLYLNQY 116 69**************************************************************************************** PP NF-YB 91 relegekk 98 re+eg++k Kalax.0637s0007.3.p 117 REIEGDTK 124 *****975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.4E-53 | 23 | 139 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.25E-40 | 30 | 149 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.9E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-18 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-18 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 1.5E-18 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MAEAPASPGG GGSHDSGGDH SPRSNNVREQ DRFLPIANIS RIMKKALPAN GKIAKDAKET 60 VQECVSEFIS FVTSEASDKC LKEKRKTVNG DDLLWAMGTL GFEDYIDPLR LYLNQYREIE 120 GDTKGTAKGG DASAKKDTGV HPQESNVLAS QGSYSQGMNY VNSRGQHMIV PMQGSE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-46 | 26 | 118 | 1 | 93 | NF-YB |
4awl_B | 1e-46 | 26 | 118 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-46 | 26 | 118 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009620316.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X4 | ||||
Refseq | XP_016449854.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Swissprot | Q8VYK4 | 5e-84 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1S3YCJ2 | 8e-99 | A0A1S3YCJ2_TOBAC; nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
STRING | XP_009620316.1 | 1e-99 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-78 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0637s0007.3.p |
Publications ? help Back to Top | |||
---|---|---|---|
|