PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0456s0006.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 196aa MW: 22355.4 Da PI: 10.406 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.7 | 2.4e-31 | 30 | 79 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+ Kalax.0456s0006.2.p 30 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 79 79***********************************************8 PP | |||||||
2 | K-box | 106.1 | 4.1e-35 | 97 | 191 | 4 | 98 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 ss+ + e++++ +qqe++kL k+i+++q+ +Rh++Ge L++L++keL++Le++Lek+l+++RskKn+ll++ ie +qk+e elq++n++ Kalax.0456s0006.2.p 97 SSNPGTVETNTQFYQQEASKLGKQIREMQNANRHIQGEALGNLTVKELKNLESRLEKGLSRVRSKKNDLLFADIEFMQKREMELQNANMY 186 444458899********************************************************************************* PP K-box 94 Lrkkl 98 Lr+k+ Kalax.0456s0006.2.p 187 LRAKV 191 **996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.9E-40 | 22 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.193 | 22 | 82 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.12E-33 | 23 | 111 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.20E-44 | 23 | 99 | No hit | No description |
PRINTS | PR00404 | 3.8E-33 | 24 | 44 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 24 | 78 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.9E-27 | 31 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-33 | 44 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-33 | 59 | 80 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.6E-27 | 105 | 191 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.617 | 107 | 195 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MEFPNFQHNQ SSEGSSSLRK LAGRGKIEIK RIENTTNRQV TFCKRRNGLL KKAYELSVLC 60 DAEVALVVFS SRGRLYEYAN NSVRSTIERY KKASSDSSNP GTVETNTQFY QQEASKLGKQ 120 IREMQNANRH IQGEALGNLT VKELKNLESR LEKGLSRVRS KKNDLLFADI EFMQKREMEL 180 QNANMYLRAK VPISI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_R | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_S | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_A | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_B | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_C | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_D | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_E | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_F | 8e-22 | 23 | 107 | 2 | 82 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00093 | SELEX | Transfer from AT3G58780 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021898389.1 | 1e-105 | agamous-like MADS-box protein AGL1 isoform X2 | ||||
Swissprot | P29381 | 3e-99 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
TrEMBL | Q9XHM3 | 1e-105 | Q9XHM3_LIQST; AGAMOUS homolog (Fragment) | ||||
STRING | EMJ18463 | 1e-101 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 1e-101 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0456s0006.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|