PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kalax.0452s0018.1.p

Organism

Kalanchoe marnieriana

Taxonomic ID

80907

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

MIKC_MADS

Protein Properties

Length: 231aa MW: 26718.4 Da PI: 9.7827

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kalax.0452s0018.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	93.6	8.9e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrqvtf+kRrng++KKA+ELSvLCdae+a+++fs++g+lyeys+ Kalax.0452s0018.1.p 9 KKIENPTNRQVTFCKRRNGLMKKAYELSVLCDAEIALMVFSNRGRLYEYSN 59 68***********************************************95 PP
2	K-box	109.7	3.1e-36	77	174	3	100
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 ++s+ +++ ++a+ +qqe++kL+++i+ Lq+++Rhl+Ge+L+sL++keL+qLe++Le+++++iRskK+e+ll++ie+lqk+e el++e+ Kalax.0452s0018.1.p 77 STSSANTTVTNAQFYQQESTKLRQQIHLLQNTNRHLMGESLGSLNVKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKREMELENETI 166 45555689999***************************************************************************** PP K-box 93 aLrkklee 100 +Lr+k++e Kalax.0452s0018.1.p 167 CLRAKVAE 174 ***986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.0E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.193	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.29E-42	2	79	No hit	No description
SuperFamily	SSF55455	4.06E-32	2	80	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.1E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	4.9E-28	86	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.555	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 231 aa Download sequence Send to blast
MGRGKIEIKK IENPTNRQVT FCKRRNGLMK KAYELSVLCD AEIALMVFSN RGRLYEYSNN 60 NSIKSTIERY KKAYSDSTSS ANTTVTNAQF YQQESTKLRQ QIHLLQNTNR HLMGESLGSL 120 NVKELKQLEN RLERGITRIR SKKHEMLLAE IEYLQKREME LENETICLRA KVAEVERFQQ 180 ANMEAANQEF NTIQAYVARN FFQPDLLQGA DDGSHVNHFT HPDKKIIRLG *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_R	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_S	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
6bz1_A	2e-19	1	85	1	84	MEF2 CHIMERA
6bz1_B	2e-19	1	85	1	84	MEF2 CHIMERA
6bz1_C	2e-19	1	85	1	84	MEF2 CHIMERA
6bz1_D	2e-19	1	85	1	84	MEF2 CHIMERA
6c9l_A	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_B	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_C	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_D	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_E	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_F	2e-19	1	61	1	61	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021614255.1	1e-123	agamous-like MADS-box protein AGL11 isoform X1
Swissprot	F6I457	1e-122	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A2H4L6S5	1e-125	A0A2H4L6S5_CERJA; AGL11
STRING	XP_006478206.1	1e-122	(Citrus sinensis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.1	2e-99	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Kalax.0452s0018.1.p

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]