PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0351s0031.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 142aa MW: 16179.2 Da PI: 8.4904 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 35.9 | 1.6e-11 | 65 | 125 | 1 | 61 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 ++e k+ +r+ +NR++A+ R+RKk ++ e+++ eL++ N++L +++++l +e a l++ Kalax.0351s0031.1.p 65 DREHKKIKRLLRNRVSAQLARERKKVYVSDMEQRARELQESNSRLEEKISTLINENAMLRK 125 5899**************************************************9997765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.7E-12 | 65 | 129 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.2E-11 | 66 | 125 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.093 | 67 | 127 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.75E-12 | 69 | 127 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-15 | 69 | 127 | No hit | No description |
CDD | cd14704 | 2.40E-14 | 70 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MISRSTPSST EQASDPLQLA PRKEEVSEED DDLFMVPEME DAAQRKGNDV GGAQEKRGRS 60 RNTADREHKK IKRLLRNRVS AQLARERKKV YVSDMEQRAR ELQESNSRLE EKISTLINEN 120 AMLRKVLISC RPKIENADSE P* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in light. Acts downstream of the light receptor network and directly affects transcription of light-induced genes. Specifically involved in the blue light specific pathway, suggesting that it participates in transmission of cryptochromes (CRY1 and CRY2) signals to downstream responses. In darkness, its degradation prevents the activation of light-induced genes. {ECO:0000269|PubMed:12023303}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011621879.1 | 6e-36 | transcription factor HY5-like isoform X1 | ||||
Swissprot | Q8W191 | 5e-34 | HYH_ARATH; Transcription factor HY5-like | ||||
TrEMBL | A0A1D1XKJ3 | 4e-35 | A0A1D1XKJ3_9ARAE; Transcription factor HY5-like | ||||
TrEMBL | A0A218VSB3 | 5e-35 | A0A218VSB3_PUNGR; Uncharacterized protein | ||||
STRING | XP_010505598.1 | 9e-35 | (Camelina sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17609.2 | 2e-36 | HY5-homolog |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0351s0031.1.p |