PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0256s0013.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 76aa MW: 8067.6 Da PI: 10.7197 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 126.3 | 9.7e-40 | 9 | 75 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 a++ +G+n Glivllvv gll++flvgny+lyvyaqk+lPPrkkkPvskkklkre+lkqGv++PGe Kalax.0256s0013.1.p 9 ANAGGQGFNAGLIVLLVVVGLLVTFLVGNYVLYVYAQKTLPPRKKKPVSKKKLKRERLKQGVSAPGE 75 556669************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 7.7E-38 | 13 | 75 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MDDDLGAKAN AGGQGFNAGL IVLLVVVGLL VTFLVGNYVL YVYAQKTLPP RKKKPVSKKK 60 LKRERLKQGV SAPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010104121.2 | 1e-27 | DNA-binding protein S1FA | ||||
Refseq | XP_024026346.1 | 1e-27 | DNA-binding protein S1FA | ||||
Swissprot | Q42337 | 1e-12 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | W9SCA3 | 3e-26 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
STRING | XP_010104121.1 | 6e-27 | (Morus notabilis) |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0256s0013.1.p |