PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0247s0025.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 189aa MW: 21610.9 Da PI: 10.8593 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.4 | 1.2e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien +nrq+tfskRr gilKKA+ELSvLC+aev ++++ss+g+ y ++s Kalax.0247s0025.1.p 9 KRIENATNRQITFSKRRYGILKKAFELSVLCEAEVVLLVLSSSGHSYNFAS 59 79**********************************************986 PP | |||||||
2 | K-box | 55.5 | 2.4e-19 | 84 | 148 | 12 | 76 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 +++e ++ e++ +k++i++L+ +q+h+ Ged++ L l eL+qLe++++++++++RskK+ +l++ Kalax.0247s0025.1.p 84 NTTEFWRCEIEEMKRRIDSLEASQKHFAGEDITVLGLGELKQLERKVKTGVERVRSKKSAVLTAT 148 56899********************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.221 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.0E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.86E-32 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 2.35E-28 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.2E-21 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-20 | 85 | 184 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.81 | 86 | 188 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MGRGKVELKR IENATNRQIT FSKRRYGILK KAFELSVLCE AEVVLLVLSS SGHSYNFASH 60 NVDRTIARYR NDVGLPRPAN QLLNTTEFWR CEIEEMKRRI DSLEASQKHF AGEDITVLGL 120 GELKQLERKV KTGVERVRSK KSAVLTATWL VSTLQRRILS EHISSLKQKH RALQEENTRL 180 QIKVRAVN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6bz1_A | 2e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022737049.1 | 1e-75 | truncated transcription factor CAULIFLOWER A-like | ||||
TrEMBL | A0A2R6PSH8 | 3e-77 | A0A2R6PSH8_ACTCH; MADS-box transcription factor (Fragment) | ||||
STRING | VIT_17s0000g01230.t01 | 2e-73 | (Vitis vinifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.1 | 6e-29 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0247s0025.1.p |