PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0237s0013.6.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 228aa MW: 25639.6 Da PI: 9.7987 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.7 | 6.3e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien+ rqvtfskRr+g+lKKA+ELS+LCda+v v+ifsstgkly+y+s Kalax.0237s0013.6.p 9 KRIENTNSRQVTFSKRRKGLLKKAKELSILCDAQVGVMIFSSTGKLYDYAS 59 79***********************************************86 PP | |||||||
2 | K-box | 58.4 | 3e-20 | 88 | 155 | 11 | 78 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqie 78 ++ + +++e+a L++++++Lq+ +R++ e+L sL++keLq+Le+qLe lk iR kK l+ ++ Kalax.0237s0013.6.p 88 KSPLQFWKNEVATLQQQLQSLQEDHRKVFTEELASLTIKELQHLENQLEMNLKCIRMKKGSLIQQENL 155 56689*******************************************************99988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.894 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.32E-41 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 2.22E-29 | 2 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.871 | 91 | 207 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.0E-17 | 91 | 160 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MGRGKIVIKR IENTNSRQVT FSKRRKGLLK KAKELSILCD AQVGVMIFSS TGKLYDYASK 60 ASIKATIEEY NKLKGDPLHP ANPSSEVKSP LQFWKNEVAT LQQQLQSLQE DHRKVFTEEL 120 ASLTIKELQH LENQLEMNLK CIRMKKGSLI QQENLDLHNQ AMCHIKNIQV HDMRAPNVVK 180 AAPLYMDNVC GENGTPVHVQ LQLRQPQPQP QSNELASGNV IVGLHLN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-18 | 1 | 91 | 1 | 88 | MEF2C |
5f28_B | 4e-18 | 1 | 91 | 1 | 88 | MEF2C |
5f28_C | 4e-18 | 1 | 91 | 1 | 88 | MEF2C |
5f28_D | 4e-18 | 1 | 91 | 1 | 88 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016737537.1 | 9e-73 | PREDICTED: MADS-box transcription factor 23 isoform X2 | ||||
Swissprot | A2RVQ5 | 3e-66 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A0D2ST39 | 2e-71 | A0A0D2ST39_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8NEV7 | 2e-71 | A0A1U8NEV7_GOSHI; MADS-box transcription factor 23 isoform X2 | ||||
STRING | GLYMA13G32810.1 | 4e-69 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 4e-65 | AGAMOUS-like 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0237s0013.6.p |
Publications ? help Back to Top | |||
---|---|---|---|
|