PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0205s0078.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 120aa MW: 13826.9 Da PI: 10.7486 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.8 | 9.3e-33 | 34 | 92 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r a+d+ vv++tYeg H h+ Kalax.0205s0078.1.p 34 LDDGYRWRKYGQKAVKNNTFPRSYYRCTHPGCHVKKQVQRMAKDKGVVTTTYEGVHSHP 92 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.0E-34 | 19 | 92 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.16E-29 | 26 | 93 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.931 | 29 | 94 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.1E-35 | 34 | 93 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-26 | 35 | 92 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MRMLGVNSKS SKRCEKKARK PRYAFQTRSA VDILDDGYRW RKYGQKAVKN NTFPRSYYRC 60 THPGCHVKKQ VQRMAKDKGV VTTTYEGVHS HPIQKPADNF ESMLRQMQIY NPSLNPTSA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-28 | 24 | 93 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 1e-28 | 24 | 93 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012446088.1 | 2e-59 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_016686835.1 | 2e-59 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_016725404.1 | 2e-59 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_017621630.1 | 2e-59 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 1e-49 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A068LC56 | 4e-58 | A0A068LC56_GOSHI; WRKY transcription factor 2 | ||||
STRING | Gorai.001G273100.1 | 8e-59 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 4e-52 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0205s0078.1.p |