PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0191s0031.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 236aa MW: 26934.8 Da PI: 9.7449 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.4 | 5.3e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl++y++ Kalax.0191s0031.1.p 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFDYAT 59 79***********************************************86 PP | |||||||
2 | K-box | 100 | 3.4e-33 | 81 | 174 | 7 | 100 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 ++++ + s++ e+a+Lk++ie L+++qRh++GedL+sL lkeLq+Le+qL+++lk+iR+kK++l++e+i+elqkk k+l+e+n++L k Kalax.0191s0031.1.p 81 IPTDTESNGSWHLEHARLKARIEALEQKQRHYMGEDLDSLILKELQNLENQLDSALKHIRAKKSQLMFESISELQKKDKQLHEQNTSLAK 170 4466777899******************************************************************************** PP K-box 97 klee 100 +++e Kalax.0191s0031.1.p 171 QMKE 174 9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.338 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.7E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.37E-40 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.29E-32 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.9E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.4E-28 | 86 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.583 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 236 aa Download sequence Send to blast |
MGRGRVQMKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFDYATD 60 SCMDRILERH ERYSSAEKQL IPTDTESNGS WHLEHARLKA RIEALEQKQR HYMGEDLDSL 120 ILKELQNLEN QLDSALKHIR AKKSQLMFES ISELQKKDKQ LHEQNTSLAK QMKEREKPQV 180 MDQQSHIQPP LEASTGIGGG NYIYRGARDH GGTASSALHL TTLLPQWMLM SRLGE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6byy_A | 1e-22 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6byy_B | 1e-22 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6byy_C | 1e-22 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6byy_D | 1e-22 | 1 | 84 | 1 | 83 | MEF2 CHIMERA |
6c9l_A | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-22 | 1 | 84 | 1 | 83 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007037634.2 | 1e-102 | PREDICTED: truncated transcription factor CAULIFLOWER A isoform X2 | ||||
Swissprot | Q42429 | 1e-99 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | A0A1S3YGF6 | 1e-100 | A0A1S3YGF6_TOBAC; agamous-like MADS-box protein AGL8 homolog | ||||
STRING | XP_009625854.1 | 1e-101 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 3e-93 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0191s0031.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|