PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0110s0038.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 232aa MW: 26015 Da PI: 9.4011 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.1 | 2.1e-18 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd +l ++v+ +G+g+W++Ia++ g++R++k+c++rw +yl Kalax.0110s0038.1.p 16 RGLWTEEEDRILMEYVEVHGKGHWNRIAKKTGLKRCGKSCRLRWVNYL 63 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 58.4 | 1.6e-18 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l Kalax.0110s0038.1.p 69 RGSFTEQEEDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNYWNTHL 114 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.142 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.23E-31 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.8E-15 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.2E-17 | 16 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-25 | 17 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.00E-12 | 19 | 63 | No hit | No description |
PROSITE profile | PS51294 | 26.058 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-17 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-17 | 69 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.5E-26 | 71 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.73E-12 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045165 | Biological Process | cell fate commitment | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MEAAGGGGGG SRQYRRGLWT EEEDRILMEY VEVHGKGHWN RIAKKTGLKR CGKSCRLRWV 60 NYLSPNVKRG SFTEQEEDLI IRLHKLLGNR WSLIAGRVPG RTDNQVKNYW NTHLSKRNGC 120 AKRQRTESYA VNPDTKSAAC SKSSETVTTG SFISLDPHKD KTGSTTENTE KETAAATARE 180 NHLISVASLP QIAGASWREQ MSSSYESLMQ FSDEFLQFDF GWNNLSSLFS D* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-28 | 16 | 117 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_196979.1 | 3e-70 | myb domain protein 66 | ||||
Swissprot | Q9SEI0 | 2e-71 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A2G5F1U0 | 9e-69 | A0A2G5F1U0_AQUCA; Uncharacterized protein | ||||
TrEMBL | A0A384KIP7 | 6e-69 | A0A384KIP7_ARATH; WER1 | ||||
TrEMBL | C0SVP6 | 6e-69 | C0SVP6_ARATH; Uncharacterized protein At5g14750 (Fragment) | ||||
STRING | Aquca_002_00170.1 | 1e-69 | (Aquilegia coerulea) | ||||
STRING | AT5G14750.1 | 1e-69 | (Arabidopsis thaliana) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 7e-72 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0110s0038.1.p |