PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0055s0091.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 198aa MW: 21791 Da PI: 10.3486 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 194.4 | 1.6e-60 | 23 | 160 | 2 | 139 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 v+k+kaal+v +v+ptf +ldsg l+l+r+G ++l++ +a++erkydWek+qsfalsatev++l+ l++++sceffhdp++k+sn+G+vr Kalax.0055s0091.2.p 23 VFKGKAALSVSPVLPTFRKLDSGGLQLDRRGVMMLNIWPAIGERKYDWEKRQSFALSATEVGSLLTLGPQDSCEFFHDPSMKTSNAGQVR 112 9***************************************************************************************** PP Whirly 92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139 k+l+++ +d sG+f++lsv n+++k+ e+++vPv+ aefav+r++++ Kalax.0055s0091.2.p 113 KSLSIKANADNSGYFFSLSVANNILKTSERLTVPVTSAEFAVMRTAFS 160 *********************************************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.7E-73 | 11 | 174 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 1.18E-63 | 15 | 179 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 8.3E-60 | 23 | 157 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MATARKRINR DNPSSKVYAP FTVFKGKAAL SVSPVLPTFR KLDSGGLQLD RRGVMMLNIW 60 PAIGERKYDW EKRQSFALSA TEVGSLLTLG PQDSCEFFHD PSMKTSNAGQ VRKSLSIKAN 120 ADNSGYFFSL SVANNILKTS ERLTVPVTSA EFAVMRTAFS FALPHIMGWD RIACQLSAGV 180 SYSTKAAPLV KDMEWDR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 2e-89 | 1 | 172 | 1 | 166 | StWhy2 |
3n1i_A | 2e-89 | 1 | 172 | 1 | 166 | protein StWhy2 |
3n1j_A | 2e-89 | 1 | 172 | 1 | 166 | Protein StWhy2 |
3n1k_A | 2e-89 | 1 | 172 | 1 | 166 | protein StWhy2 |
3n1l_A | 2e-89 | 1 | 172 | 1 | 166 | protein StWhy2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009772779.1 | 6e-95 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 | ||||
Refseq | XP_009772788.1 | 6e-95 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 | ||||
Refseq | XP_016511177.1 | 6e-95 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 | ||||
Refseq | XP_016511178.1 | 6e-95 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4 | ||||
Refseq | XP_019236145.1 | 6e-95 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 | ||||
Swissprot | D9J034 | 3e-93 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A1S4DCK9 | 1e-93 | A0A1S4DCK9_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 | ||||
TrEMBL | A0A1S4DCW1 | 1e-93 | A0A1S4DCW1_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4 | ||||
TrEMBL | A0A1U7W2E7 | 1e-93 | A0A1U7W2E7_NICSY; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 | ||||
TrEMBL | A0A1U7WDQ3 | 1e-93 | A0A1U7WDQ3_NICSY; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 | ||||
STRING | XP_009772771.1 | 7e-94 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 2e-87 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0055s0091.2.p |