PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0041s0113.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 231aa MW: 26592.3 Da PI: 9.3918 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.5 | 2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtf+kRrng++KKA+ELSvLCdaeva+++fs++g+lyeys+ Kalax.0041s0113.1.p 9 KRIENVTSRQVTFCKRRNGLMKKAYELSVLCDAEVALMVFSTRGRLYEYSN 59 79***********************************************95 PP | |||||||
2 | K-box | 106.6 | 3e-35 | 79 | 174 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 + +++ ++ + +qqe+akL+++i+++q+++R+l+Ge+L+sL++keL+qLe++Le+++++iRskK+e+ll++ie lqk+e el++e+ +L Kalax.0041s0113.1.p 79 TAANTTVTNVQFYQQESAKLRQQIHMIQNTNRNLMGESLGSLNVKELKQLENRLERGVTRIRSKKHEMLLAEIEFLQKREIELENETICL 168 455578899********************************************************************************* PP K-box 95 rkklee 100 r+k++e Kalax.0041s0113.1.p 169 RAKVAE 174 ***986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.039 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.53E-41 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.06E-31 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.2E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.4E-26 | 86 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.015 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 231 aa Download sequence Send to blast |
MGRGKIEIKR IENVTSRQVT FCKRRNGLMK KAYELSVLCD AEVALMVFST RGRLYEYSNN 60 NSIKSTIERY KKACSDSTTA ANTTVTNVQF YQQESAKLRQ QIHMIQNTNR NLMGESLGSL 120 NVKELKQLEN RLERGVTRIR SKKHEMLLAE IEFLQKREIE LENETICLRA KVAEVERLQQ 180 ANMEAANQEF NTIQAYVARN FFQHDLLQGA DNASQVNHFA LPDDKILRLE * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-18 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021614255.1 | 1e-120 | agamous-like MADS-box protein AGL11 isoform X1 | ||||
Swissprot | F6I457 | 1e-120 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A2H4L6S5 | 1e-120 | A0A2H4L6S5_CERJA; AGL11 | ||||
STRING | XP_006478206.1 | 1e-119 | (Citrus sinensis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-106 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0041s0113.1.p |