PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0036s0028.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 87aa MW: 9843.11 Da PI: 7.6177 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 28.5 | 2.7e-09 | 14 | 54 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + +++L +llP++ + +s K+s a +L++++ YI++L Kalax.0036s0028.1.p 14 DQIHDLISKLHQLLPELRHSRSDKVSAAKVLQETCSYIRNL 54 6899************889********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 10.239 | 1 | 54 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 1.5E-8 | 14 | 75 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 5.89E-9 | 14 | 72 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 8.9E-7 | 14 | 54 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MSSRRSRSSR ISDDQIHDLI SKLHQLLPEL RHSRSDKVSA AKVLQETCSY IRNLDREVDD 60 LSERLSELLA NADNAQAAII RNLLMQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20023194, ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:22339648}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016176744.1 | 5e-41 | transcription factor PRE3 | ||||
Refseq | XP_025631120.1 | 5e-41 | transcription factor PRE3-like | ||||
Swissprot | Q9CA64 | 2e-34 | PRE3_ARATH; Transcription factor PRE3 | ||||
TrEMBL | A0A445AZU5 | 1e-39 | A0A445AZU5_ARAHY; Uncharacterized protein | ||||
STRING | Gorai.007G036200.1 | 2e-37 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74500.1 | 2e-35 | activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0036s0028.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|