PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0031s0061.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 100aa MW: 11725.2 Da PI: 9.9783 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46 | 1.1e-14 | 10 | 70 | 2 | 62 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +e+k+ +r+ NRe+Arr R RK++ + +L+ +v++L ++N++L ++l +l + ++ +e Kalax.0031s0061.1.p 10 QEIKKLKRRFANRESARRARVRKQQLVHHLQMEVDKLAKQNQDLLQKLVQLAECHQQSLME 70 799***********************************************99988776666 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.1E-10 | 9 | 62 | No hit | No description |
SMART | SM00338 | 1.9E-7 | 9 | 73 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.4E-12 | 10 | 71 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.335 | 11 | 62 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 8.13E-10 | 12 | 64 | No hit | No description |
CDD | cd14702 | 3.71E-8 | 14 | 65 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 16 | 31 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
NNGDDDHVDQ EIKKLKRRFA NRESARRARV RKQQLVHHLQ MEVDKLAKQN QDLLQKLVQL 60 AECHQQSLME NLRLREEINL FHKFASNMHA AASSHHPEQ* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 25 | 31 | RRARVRK |
2 | 25 | 32 | RRARVRKQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68880.1 | 1e-11 | basic leucine-zipper 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0031s0061.1.p |