PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0021s0131.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 199aa MW: 22552.1 Da PI: 7.7034 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83 | 1.9e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtf+kRr+gilKKA+ELSvLCdae+ v ifs +gkl+ey+s Kalax.0021s0131.1.p 9 KRIENPVHRQVTFCKRRAGILKKAKELSVLCDAEIGVFIFSAHGKLFEYAS 59 79***********************************************86 PP | |||||||
2 | K-box | 60.9 | 5.3e-21 | 91 | 176 | 15 | 100 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + +e++ Lkkeie+Lq+ R + G + +++++ eL+ e++Le + +iRs+K+e ++++ie+l++ke l+ +n L++k+ e Kalax.0021s0131.1.p 91 KDAIEEINMLKKEIESLQQVMRFMFGGGTGTMNVDELHVQEKHLEALIYHIRSTKMEAMFQEIETLKNKEGVLKAANSFLQQKMHE 176 455689****************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.73 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.50E-39 | 2 | 74 | No hit | No description |
PRINTS | PR00404 | 1.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.23E-29 | 3 | 82 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.612 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.6E-19 | 92 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MARGKVQMKR IENPVHRQVT FCKRRAGILK KAKELSVLCD AEIGVFIFSA HGKLFEYASK 60 GSMQGLIDRY TKSTTGETPL HQETEYSAFQ KDAIEEINML KKEIESLQQV MRFMFGGGTG 120 TMNVDELHVQ EKHLEALIYH IRSTKMEAMF QEIETLKNKE GVLKAANSFL QQKMHERVEE 180 MAADDFAALA ASVQFPIF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 7e-18 | 1 | 98 | 1 | 89 | MEF2C |
5f28_B | 7e-18 | 1 | 98 | 1 | 89 | MEF2C |
5f28_C | 7e-18 | 1 | 98 | 1 | 89 | MEF2C |
5f28_D | 7e-18 | 1 | 98 | 1 | 89 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027093414.1 | 1e-86 | agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 9e-69 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A059BU68 | 4e-82 | A0A059BU68_EUCGR; Uncharacterized protein | ||||
STRING | XP_010062376.1 | 6e-83 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 2e-59 | AGAMOUS-like 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0021s0131.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|