PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kalax.0016s0241.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 183aa MW: 20025.4 Da PI: 10.1268 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.7 | 3.9e-33 | 105 | 161 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+Rg+gGrF Kalax.0016s0241.2.p 105 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGCGGRF 161 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-36 | 103 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.283 | 104 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 5.3E-28 | 106 | 161 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.6E-23 | 107 | 129 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 109 | 129 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.6E-23 | 138 | 161 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MTSTVHHSGQ QKQSEHGIHA AAAGTGISHP DITNIANVPF PTPSHLGVGH AQAAYPFPDP 60 YYRSIFTSHE AQPYPAQPYS PQPMVHMQLM GIQQAGLPLP SDVVEEPVFV NAKQYHGILR 120 RRQSRAKAES ENKLAKSRKP YLHESRHLHA LRRARGCGGR FLNAKKNENS QQNESTSGGS 180 SH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-21 | 104 | 169 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010655736.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_018847860.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_018847861.1 | 2e-87 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 1e-56 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2I4GVD2 | 4e-86 | A0A2I4GVD2_JUGRE; nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | D7TKH6 | 4e-86 | D7TKH6_VITVI; Uncharacterized protein | ||||
STRING | VIT_10s0003g04650.t01 | 6e-87 | (Vitis vinifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 3e-56 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kalax.0016s0241.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|