PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0418s0009.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 155aa MW: 17676.9 Da PI: 10.7362 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.6 | 4.5e-16 | 10 | 58 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+l +++ ++Gg+ +W++++ ++g+ R +k+c++rw +yl Kaladp0418s0009.1.p 10 RGLWSPEEDEKLRNYILRHGGHgSWSSVPVEIGLQRNGKSCRLRWINYL 58 788******************9*************************97 PP | |||||||
2 | Myb_DNA-binding | 50 | 6.9e-16 | 64 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++t E+e + +++ lG++ W+ Ia++++ gRt++++k++w+++l Kaladp0418s0009.1.p 64 RGMFSTAEEETIMALHRDLGNK-WSQIAQKLP-GRTDNEIKNYWHTHL 109 788*******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.815 | 5 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.24E-27 | 7 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-10 | 9 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-14 | 10 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-21 | 11 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.46E-8 | 13 | 58 | No hit | No description |
PROSITE profile | PS51294 | 24.317 | 59 | 113 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-12 | 63 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-14 | 64 | 109 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-25 | 66 | 112 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.31E-10 | 67 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0010018 | Biological Process | far-red light signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MGSEKPKHRR GLWSPEEDEK LRNYILRHGG HGSWSSVPVE IGLQRNGKSC RLRWINYLRP 60 GLKRGMFSTA EEETIMALHR DLGNKWSQIA QKLPGRTDNE IKNYWHTHLK KRIGGTFSSA 120 PKTSQELINS WSTNVSSTFS SPNYSSKPLT QVPSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-21 | 6 | 113 | 3 | 108 | B-MYB |
1h8a_C | 1e-20 | 6 | 113 | 23 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021648305.1 | 2e-64 | transcription factor LAF1-like | ||||
Swissprot | Q9M0K4 | 2e-55 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A218WTD0 | 3e-62 | A0A218WTD0_PUNGR; Uncharacterized protein | ||||
STRING | cassava4.1_031686m | 2e-62 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25560.1 | 2e-57 | myb domain protein 18 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0418s0009.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|