PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0076s0304.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 156aa MW: 17538.9 Da PI: 10.5113 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.5 | 7.3e-19 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l ++++q+G g+W+t ++ g+ R++k+c++rw +yl Kaladp0076s0304.1.p 21 KGPWTAEEDLKLREYIEQHGAGNWRTLPENAGLQRCGKSCRLRWTNYL 68 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.4e-17 | 74 | 118 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ eE+e +++++ lG++ W++Ia++++ gRt++++k++w+++ Kaladp0076s0304.1.p 74 RGRFSFEEEEAIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 118 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.6E-25 | 15 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.576 | 16 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.24E-32 | 18 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-14 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.9E-17 | 21 | 68 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.47E-11 | 23 | 68 | No hit | No description |
PROSITE profile | PS51294 | 25.446 | 69 | 123 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-27 | 72 | 123 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-16 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.2E-16 | 74 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.25E-11 | 76 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MGRAPATSSS SSRSSSSGLK KGPWTAEEDL KLREYIEQHG AGNWRTLPEN AGLQRCGKSC 60 RLRWTNYLRP DIKRGRFSFE EEEAIIQLHS VLGNKWSAIA ARLPGRTDNE IKNYWNTHIR 120 KRLLRMGLDP VTHAPRLDHL LGSTSQLSNL SNLLC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-29 | 19 | 123 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015953556.1 | 3e-85 | transcription factor MYB102-like | ||||
Refseq | XP_016191816.1 | 3e-85 | transcription factor MYB102-like | ||||
Refseq | XP_025641079.1 | 3e-85 | transcription factor MYB41 | ||||
Refseq | XP_025687556.1 | 3e-85 | transcription factor MYB41 | ||||
Swissprot | Q9LDR8 | 1e-80 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A445A5E0 | 7e-84 | A0A445A5E0_ARAHY; Uncharacterized protein | ||||
TrEMBL | A0A445E0R7 | 6e-84 | A0A445E0R7_ARAHY; Uncharacterized protein | ||||
STRING | XP_008358698.1 | 2e-81 | (Malus domestica) | ||||
STRING | XP_009764351.1 | 7e-82 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 6e-81 | MYB-like 102 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0076s0304.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|