PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kaladp0059s0321.1.p

Organism

Kalanchoe laxiflora

Taxonomic ID

1670617

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

bZIP

Protein Properties

Length: 142aa MW: 16226.2 Da PI: 8.4904

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kaladp0059s0321.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	36.4	1.2e-11	65	125	1	61
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 ++e k+ +r+ +NR++A+ R+RKk ++ e+++ eL++ N++L +++++l +e a l++ Kaladp0059s0321.1.p 65 DREHKKIKRLLRNRLSAQQARERKKVYVSDMEQRARELQESNSRLEEKISTLINENAMLRK 125 5899**************************************************9997765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.4E-11	65	129	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.6E-11	66	125	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.45	67	127	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.2E-15	69	127	No hit	No description
SuperFamily	SSF57959	1.31E-12	69	127	No hit	No description
CDD	cd14704	1.19E-13	70	121	No hit	No description
PROSITE pattern	PS00036	0	72	87	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010224	Biological Process	response to UV-B
GO:0080167	Biological Process	response to karrikin
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MMSRSTPSST EQASDPLQLA PRKEEVSEED DDLFMVPEME DAAQRKGNDV GGAQEKRGRS 60 RNTADREHKK IKRLLRNRLS AQQARERKKV YVSDMEQRAR ELQESNSRLE EKISTLINEN 120 AMLRKVLISC RPKIENADSE P*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in light. Acts downstream of the light receptor network and directly affects transcription of light-induced genes. Specifically involved in the blue light specific pathway, suggesting that it participates in transmission of cryptochromes (CRY1 and CRY2) signals to downstream responses. In darkness, its degradation prevents the activation of light-induced genes. {ECO:0000269\|PubMed:12023303}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011621879.1	9e-37	transcription factor HY5-like isoform X1
Swissprot	Q8W191	1e-34	HYH_ARATH; Transcription factor HY5-like
TrEMBL	A0A1D1XKJ3	5e-36	A0A1D1XKJ3_9ARAE; Transcription factor HY5-like
STRING	XP_010505598.1	2e-35	(Camelina sativa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G17609.2	5e-37	HY5-homolog

Link Out ? help Back to Top
Phytozome	Kaladp0059s0321.1.p

Publications ? help Back to Top
Gangappa SN,Holm M,Botto JF Molecular interactions of BBX24 and BBX25 with HYH, HY5 HOMOLOG, to modulate Arabidopsis seedling development. Plant Signal Behav, 2014. [PMID:23733077] Ciolfi A, et al. Dynamics of the shade-avoidance response in Arabidopsis. Plant Physiol., 2013. 163(1): p. 331-53 [PMID:23893169] Kreslavski VD, et al. Effect of preillumination with red light on photosynthetic parameters and oxidant-/antioxidant balance in Arabidopsis thaliana in response to UV-A. J. Photochem. Photobiol. B, Biol., 2013. 127: p. 229-36 [PMID:24080425] Tossi V,Lamattina L,Jenkins GI,Cassia RO Ultraviolet-B-induced stomatal closure in Arabidopsis is regulated by the UV RESISTANCE LOCUS8 photoreceptor in a nitric oxide-dependent mechanism. Plant Physiol., 2014. 164(4): p. 2220-30 [PMID:24586043] Tsai HL, et al. HUA ENHANCER1 is involved in posttranscriptional regulation of positive and negative regulators in Arabidopsis photomorphogenesis. Plant Cell, 2014. 26(7): p. 2858-72 [PMID:25052717] Karumuri S,Bandopadhyay R In silico analysis of the structure and interaction of COP1 protein of Arabidopsis thaliana. Indian J. Biochem. Biophys., 2014. 51(5): p. 343-9 [PMID:25630103] Xie W, et al. Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach. Front Plant Sci, 2015. 6: p. 829 [PMID:26528302] Velanis CN,Herzyk P,Jenkins GI Regulation of transcription by the Arabidopsis UVR8 photoreceptor involves a specific histone modification. Plant Mol. Biol., 2016. 92(4-5): p. 425-443 [PMID:27534420] Loyola R, et al. The photomorphogenic factors UV-B RECEPTOR 1, ELONGATED HYPOCOTYL 5, and HY5 HOMOLOGUE are part of the UV-B signalling pathway in grapevine and mediate flavonol accumulation in response to the environment. J. Exp. Bot., 2016. 67(18): p. 5429-5445 [PMID:27543604] Feng XJ, et al. Light affects salt stress-induced transcriptional memory of P5CS1 in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(51): p. E8335-E8343 [PMID:27930298] Li C, et al. Characterization and functional analysis of four HYH splicing variants in Arabidopsis hypocotyl elongation. Gene, 2017. 619: p. 44-49 [PMID:28389360] Zhang Y, et al. Dissection of HY5/HYH expression in Arabidopsis reveals a root-autonomous HY5-mediated photomorphogenic pathway. PLoS ONE, 2017. 12(7): p. e0180449 [PMID:28683099] Woloszynska M, et al. The Elongator complex regulates hypocotyl growth in darkness and during photomorphogenesis. J. Cell. Sci., 2019. [PMID:28720596] Serivichyaswat PT,Susila H,Ahn JH Elongated Hypocotyl 5-Homolog (HYH) Negatively Regulates Expression of the Ambient Temperature-Responsive MicroRNA Gene MIR169. Front Plant Sci, 2017. 8: p. 2087 [PMID:29270188] Yang B, et al. RSM1, an Arabidopsis MYB protein, interacts with HY5/HYH to modulate seed germination and seedling development in response to abscisic acid and salinity. PLoS Genet., 2018. 14(12): p. e1007839 [PMID:30566447]