PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0059s0088.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 171aa MW: 19823.4 Da PI: 8.9379 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.2 | 2.5e-10 | 26 | 71 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 WT eE +l+ a + + ++ +W+++a++++ g++ k++++ + Kaladp0059s0088.1.p 26 YWTREENKLFESALAIYDKNtpdRWEKVAQMIP-GKSVKDVINQYKE 71 6********************************.*********9975 PP | |||||||
2 | Myb_DNA-binding | 31.2 | 4.9e-10 | 124 | 158 | 2 | 36 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRt 36 ++WT++E+ +++ + ++G+g+W++I+r + +t Kaladp0059s0088.1.p 124 LPWTEDEHRRFLMGLLKHGKGDWRSISRNFVASKT 158 69**************************9875555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.9E-6 | 16 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 10.556 | 22 | 75 | IPR017884 | SANT domain |
SMART | SM00717 | 6.6E-11 | 23 | 75 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.74E-14 | 25 | 81 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.0E-9 | 26 | 71 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.61E-9 | 27 | 72 | No hit | No description |
PROSITE profile | PS51294 | 9.669 | 118 | 170 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 1.1E-7 | 121 | 161 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 0.18 | 122 | 168 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-8 | 124 | 161 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.43E-6 | 125 | 161 | No hit | No description |
Pfam | PF00249 | 2.8E-7 | 125 | 161 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.22E-8 | 125 | 163 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MIMDTMYQTF QLQNSNCLPQ KSHSSYWTRE ENKLFESALA IYDKNTPDRW EKVAQMIPGK 60 SVKDVINQYK ELEDDVINIE AGLVPTPGYL TSSFTLELGD DRDFDVLRKK SRARSADREK 120 KKGLPWTEDE HRRFLMGLLK HGKGDWRSIS RNFVASKTPT QSYSEQNRLI * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 9e-17 | 27 | 102 | 11 | 86 | RADIALIS |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 107 | 121 | RKKSRARSADREKKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021295548.1 | 7e-75 | transcription factor DIVARICATA-like isoform X2 | ||||
Swissprot | Q8S9H7 | 2e-59 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A2N9H1W5 | 2e-75 | A0A2N9H1W5_FAGSY; Uncharacterized protein | ||||
STRING | XP_008233716.1 | 1e-73 | (Prunus mume) | ||||
STRING | EMJ20461 | 1e-73 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 2e-63 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0059s0088.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|