PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0039s0445.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 100aa MW: 11037.8 Da PI: 8.9444 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 156 | 6.6e-48 | 6 | 98 | 194 | 286 |
GAGA_bind 194 idlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpv 283 +l+ln+ +lD+ +lPvP sCtG++r CYkWGnGGWqSa Ctt++S+yP+P ++++r++R+ g KmS++af+k +La++Gyd+ p+ Kaladp0039s0445.1.p 6 GELSLNELNLDDVNLPVPFYSCTGKPRSCYKWGNGGWQSARCTTALSMYPMPLMPNKRHSRMDGCKMSGNAFTKPTTRLATDGYDITVPI 95 5899************************************************************************************** PP GAGA_bind 284 DLk 286 D+k Kaladp0039s0445.1.p 96 DMK 98 **9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 7.6E-7 | 1 | 99 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 7.6E-44 | 6 | 99 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MVEAKGELSL NELNLDDVNL PVPFYSCTGK PRSCYKWGNG GWQSARCTTA LSMYPMPLMP 60 NKRHSRMDGC KMSGNAFTKP TTRLATDGYD ITVPIDMKK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008365907.1 | 3e-38 | protein BASIC PENTACYSTEINE4-like isoform X4 | ||||
Refseq | XP_009378464.1 | 3e-38 | PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 | ||||
Refseq | XP_021806325.1 | 3e-38 | protein BASIC PENTACYSTEINE4 isoform X2 | ||||
Swissprot | Q5VSA8 | 2e-37 | BBRD_ORYSJ; Barley B recombinant-like protein D | ||||
TrEMBL | A0A3S3MKL4 | 1e-37 | A0A3S3MKL4_9MAGN; Barley B recombinant-like protein D isoform X1 | ||||
STRING | XP_008236825.1 | 3e-37 | (Prunus mume) | ||||
STRING | EMJ02466 | 3e-37 | (Prunus persica) | ||||
STRING | GSMUA_Achr1P03770_001 | 1e-37 | (Musa acuminata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21240.2 | 4e-39 | basic pentacysteine 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0039s0445.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|