PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Kaladp0039s0346.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 215aa MW: 24318.5 Da PI: 8.8076 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173.3 | 7e-54 | 5 | 129 | 1 | 127 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeelv++yL++k+++ +++ ++i+ vd++k+ePwdLp ++ +e+ewyfF +d+ky+tg r+nrat++gyWk+tgkdk Kaladp0039s0346.1.p 5 LPPGFRFHPTDEELVTYYLNNKIADCGFTC-RAITAVDLNKCEPWDLPVLASMGEREWYFFNLKDRKYPTGLRTNRATQAGYWKTTGKDK 93 79**************************99.89***************8777899*********************************** PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyr 127 e+++ +g vglkktLvfy+grapkgek++Wvmheyr Kaladp0039s0346.1.p 94 EIYK-DGVIVGLKKTLVFYRGRAPKGEKSNWVMHEYR 129 ***9.99*****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.18E-62 | 3 | 151 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.478 | 5 | 151 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-28 | 6 | 129 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MEEYLPPGFR FHPTDEELVT YYLNNKIADC GFTCRAITAV DLNKCEPWDL PVLASMGERE 60 WYFFNLKDRK YPTGLRTNRA TQAGYWKTTG KDKEIYKDGV IVGLKKTLVF YRGRAPKGEK 120 SNWVMHEYRP EAKPTFKSNK DEWVVCRVFK KSSSTAKKPP HTPSSSSQQY TALDDSSNIV 180 THDLGETIEI PNHSVPNGGQ PGLTTAVLTI NYPT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-55 | 5 | 157 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-55 | 5 | 157 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-55 | 5 | 157 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-55 | 5 | 157 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swm_B | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swm_C | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swm_D | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swp_A | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swp_B | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swp_C | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
3swp_D | 5e-55 | 5 | 157 | 20 | 174 | NAC domain-containing protein 19 |
4dul_A | 5e-55 | 5 | 157 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 5e-55 | 5 | 157 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00364 | DAP | Transfer from AT3G18400 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006440976.1 | 2e-97 | NAC domain-containing protein 92 | ||||
Swissprot | Q9FLJ2 | 2e-77 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | V4TWF0 | 4e-96 | V4TWF0_9ROSI; Uncharacterized protein | ||||
STRING | XP_006440976.1 | 7e-97 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18400.1 | 7e-93 | NAC domain containing protein 58 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Kaladp0039s0346.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|