PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Kaladp0024s0815.1.p

Organism

Kalanchoe laxiflora

Taxonomic ID

1670617

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe

Family

LBD

Protein Properties

Length: 214aa MW: 23090.6 Da PI: 7.3573

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Kaladp0024s0815.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	143.9	4.9e-45	11	110	1	100
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++r+da++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql Kaladp0024s0815.1.p 11 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHTSQRDDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQL 100 7*************************************************************************************** PP DUF260 91 kaelallkee 100 + +la +k+e Kaladp0024s0815.1.p 101 QLDLACAKSE 110 ***99887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	26.615	10	111	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	5.1E-44	11	108	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 214 aa Download sequence Send to blast
MASASALTTS PCAACKFLRR KCQPECVFAP YFPPDQPQKF ANVHKVFGAS NVTKLLNELH 60 TSQRDDAVNS LAYEADMRLR DPVYGCVGVI SLLQHQLRQL QLDLACAKSE LSKYKTAISG 120 AAAAQRSGVI QGGGAHGGHG QHHHYLGGHG QYHHQYQVVR SESSFDSGND NSNEDEFDAG 180 GFLDMLSQFQ QSAGRGGPGG EHDRRTTAAV DRF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	1e-52	10	114	10	114	LOB family transfactor Ramosa2.1
5ly0_B	1e-52	10	114	10	114	LOB family transfactor Ramosa2.1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11311158, PubMed:12787254, PubMed:12874130, PubMed:14508003, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509). Required for the binding of AS1 to the KNOX genes (PubMed:23271976). Involved in leaf polarity establishment by functioning cooperatively with RH10 or RID2 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269\|PubMed:11311158, ECO:0000269\|PubMed:12787254, ECO:0000269\|PubMed:12874130, ECO:0000269\|PubMed:14508003, ECO:0000269\|PubMed:16006579, ECO:0000269\|PubMed:16699177, ECO:0000269\|PubMed:17395603, ECO:0000269\|PubMed:17559509, ECO:0000269\|PubMed:23271976, ECO:0000269\|PubMed:27334696}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by SHOOT MERISTEMLESS (STM). {ECO:0000269\|PubMed:11934861}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002266137.1	8e-72	PREDICTED: LOB domain-containing protein 6
Swissprot	O04479	1e-66	AS2_ARATH; Protein ASYMMETRIC LEAVES 2
TrEMBL	A0A438FCF6	2e-70	A0A438FCF6_VITVI; LOB domain-containing protein 6
TrEMBL	D7SSJ3	2e-70	D7SSJ3_VITVI; Uncharacterized protein
STRING	VIT_00s0340g00090.t01	3e-71	(Vitis vinifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65620.4	4e-65	LBD family protein

Link Out ? help Back to Top
Phytozome	Kaladp0024s0815.1.p

Publications ? help Back to Top
Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Mateo-Bonmatí E, et al. Plastid control of abaxial-adaxial patterning. Sci Rep, 2015. 5: p. 15975 [PMID:26522839] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Matsumura Y, et al. A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(6): p. 661-674 [PMID:27605094] Vial-Pradel S, et al. Arabidopsis Zinc-Finger-Like Protein ASYMMETRIC LEAVES2 (AS2) and Two Nucleolar Proteins Maintain Gene Body DNA Methylation in the Leaf Polarity Gene ETTIN (ARF3). Plant Cell Physiol., 2018. 59(7): p. 1385-1397 [PMID:29415182] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]