PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | kfl00283_0190 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 184aa MW: 20010.1 Da PI: 4.8934 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185 | 5.6e-58 | 31 | 126 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdrflPian++rimk++lP+n+k++kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre+egek kfl00283_0190 31 REQDRFLPIANIGRIMKRALPSNGKVAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYRETEGEK 126 89*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-55 | 25 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.48E-41 | 33 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.1E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.9E-22 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-22 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 1.9E-22 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MSEDANGSGD PGSPGEGGEY MQQGNDGSSI REQDRFLPIA NIGRIMKRAL PSNGKVAKDA 60 KETVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM STLGFEDYVE PLKVYLHKYR 120 ETEGEKASLA KQGGGDMGRK ENVQMGSYHQ AMQPGYGGPT YGTQFAPPQS GNPYQSQQPT 180 SGPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-49 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-49 | 29 | 121 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002507332.1 | 5e-67 | histone-like transcription factor | ||||
Refseq | XP_024396797.1 | 6e-67 | nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_024396798.1 | 6e-67 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q60EQ4 | 6e-64 | NFYB3_ORYSJ; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A1Y1I8R8 | 1e-119 | A0A1Y1I8R8_KLENI; CCAAT-binding factor | ||||
STRING | XP_002507332.1 | 2e-66 | (Micromonas sp. RCC299) | ||||
STRING | PP1S83_179V6.2 | 2e-66 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-65 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|