PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00031892-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9304.95 Da PI: 10.6628

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00031892-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.4	9.5e-29	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvt+skRr+g++KKA+EL vLCda+v++i++ss+ kl++y WALNUT_00031892-RA 9 KRIENETNRQVTYSKRRKGLFKKAHELTVLCDAKVSLIMISSNKKLRDYV 58 79**********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	30.319	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.89E-30	1	70	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.7E-36	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.78E-33	2	66	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.1E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MARGKIQIKR IENETNRQVT YSKRRKGLFK KAHELTVLCD AKVSLIMISS NKKLRDYVSP 60 STTYVISFFL ILCLSSSAYT N

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-17	1	66	1	66	MEF2C
5f28_B	6e-17	1	66	1	66	MEF2C
5f28_C	6e-17	1	66	1	66	MEF2C
5f28_D	6e-17	1	66	1	66	MEF2C
6byy_A	5e-17	1	66	1	66	MEF2 CHIMERA
6byy_B	5e-17	1	66	1	66	MEF2 CHIMERA
6byy_C	5e-17	1	66	1	66	MEF2 CHIMERA
6byy_D	5e-17	1	66	1	66	MEF2 CHIMERA
6bz1_A	5e-17	1	66	1	66	MEF2 CHIMERA
6bz1_B	5e-17	1	66	1	66	MEF2 CHIMERA
6bz1_C	5e-17	1	66	1	66	MEF2 CHIMERA
6bz1_D	5e-17	1	66	1	66	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269\|PubMed:18417639, ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9489703}.
UniProt	Transcription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:19783648}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ313089	1e-82	AJ313089.1 Juglans regia partial mRNA for putative apetala 3 protein (ap3 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018859339.1	5e-53	PREDICTED: floral homeotic protein AGAMOUS-like
Swissprot	P23706	8e-32	DEFA_ANTMA; Floral homeotic protein DEFICIENS
Swissprot	P35632	9e-32	AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBL	A0A2I4HT72	1e-51	A0A2I4HT72_JUGRE; floral homeotic protein AGAMOUS-like
STRING	Migut.N03130.1.p	1e-30	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2735	33	75

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	4e-34	MIKC_MADS family protein

Publications ? help Back to Top
Schwarz-Sommer Z, et al. Characterization of the Antirrhinum floral homeotic MADS-box gene deficiens: evidence for DNA binding and autoregulation of its persistent expression throughout flower development. EMBO J., 1992. 11(1): p. 251-63 [PMID:1346760] Furner I,Ellis L,Bakht S,Mirza B,Sheikh M CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis. Plant J., 2008. 53(4): p. 645-60 [PMID:18269574] Sommer H, et al. Deficiens, a homeotic gene involved in the control of flower morphogenesis in Antirrhinum majus: the protein shows homology to transcription factors. EMBO J., 1990. 9(3): p. 605-13 [PMID:1968830] Gallois JL, et al. Functional characterization of the plant ubiquitin regulatory X (UBX) domain-containing protein AtPUX7 in Arabidopsis thaliana. Gene, 2013. 526(2): p. 299-308 [PMID:23747397] Jing D, et al. Two ancestral APETALA3 homologs from the basal angiosperm Magnolia wufengensis (Magnoliaceae) can affect flower development of Arabidopsis. Gene, 2014. 537(1): p. 100-7 [PMID:24334124] Zhang Y, et al. A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes. PLoS ONE, 2014. 9(3): p. e91804 [PMID:24632777] Nakamura Y,Liu YC,Lin YC Floral glycerolipid profiles in homeotic mutants of Arabidopsis thaliana. Biochem. Biophys. Res. Commun., 2014. 450(4): p. 1272-5 [PMID:24984150] Behrend A,Borchert T,Hohe A "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers. BMC Plant Biol., 2015. 15: p. 8 [PMID:25604890] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Yunus IS, et al. Phosphatidic acid is a major phospholipid class in reproductive organs of Arabidopsis thaliana. Plant Signal Behav, 2015. 10(8): p. e1049790 [PMID:26179579] Sun JJ, et al. CsAP3: A Cucumber Homolog to Arabidopsis APETALA3 with Novel Characteristics. Front Plant Sci, 2016. 7: p. 1181 [PMID:27540391] Davies B,Egea-Cortines M,de Andrade Silva E,Saedler H,Sommer H Multiple interactions amongst floral homeotic MADS box proteins. EMBO J., 1996. 15(16): p. 4330-43 [PMID:8861961]