PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00031834-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

MYB_related

Protein Properties

Length: 65aa MW: 7502.69 Da PI: 9.975

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00031834-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	29.8	1.4e-09	4	33	19	48
TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48 G g+W+ +ar g+ R++k+c++rw +yl WALNUT_00031834-RA 4 NGQGCWSDVARNAGLQRCGKSCRLRWINYL 33 58889***********************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.38	1	37	IPR017930	Myb domain
SuperFamily	SSF46689	4.25E-15	4	61	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-13	4	36	IPR009057	Homeodomain-like
CDD	cd00167	1.07E-4	5	33	No hit	No description
Pfam	PF13921	1.4E-7	8	48	No hit	No description
Gene3D	G3DSA:1.10.10.60	4.9E-9	37	60	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MLNNGQGCWS DVARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEALI IHLHSLLGNR 60 FFIPY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269\|PubMed:19808805, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP711284	3e-58	KP711284.1 Betula platyphylla MYB transcription factor 46 (MYB46) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009376885.1	2e-38	PREDICTED: transcription factor MYB46-like
Swissprot	Q9C6U1	1e-34	MYB83_ARATH; Transcription factor MYB83
TrEMBL	A0A498KCJ9	9e-37	A0A498KCJ9_MALDO; Uncharacterized protein
TrEMBL	M5WGP8	4e-37	M5WGP8_PRUPE; Uncharacterized protein
STRING	XP_009376885.1	7e-38	(Pyrus x bretschneideri)
STRING	EMJ12962	7e-38	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF774	34	128

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G08500.1	4e-37	myb domain protein 83

Publications ? help Back to Top
Vargas L, et al. Improving total saccharification yield of Arabidopsis plants by vessel-specific complementation of caffeoyl shikimate esterase (cse) mutants. Biotechnol Biofuels, 2016. 9: p. 139 [PMID:27390589] Piya S,Kihm C,Rice JH,Baum TJ,Hewezi T Cooperative Regulatory Functions of miR858 and MYB83 during Cyst Nematode Parasitism. Plant Physiol., 2017. 174(3): p. 1897-1912 [PMID:28512179]