PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00026722-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

ZF-HD

Protein Properties

Length: 98aa MW: 10532.6 Da PI: 8.7864

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00026722-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.6	5.4e-32	25	81	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 ++vrY eC+kNhAa +Gg+avDGC+Efm+s geegt aa++CaACgCHRnFHRreve+ WALNUT_00026722-RA 25 RTVRYGECQKNHAAGIGGYAVDGCREFMAS-GEEGTGAAFTCAACGCHRNFHRREVES 81 579************************9.999*******************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	8.0E-17	1	95	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.3E-30	27	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.8E-26	28	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.942	29	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MRKRQVVLRR QEPSGNSTTS SATARTVRYG ECQKNHAAGI GGYAVDGCRE FMASGEEGTG 60 AAFTCAACGC HRNFHRREVE STSTEVGFER ASPSSNGR

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018812238.1	1e-65	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9LJW5	9e-37	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A2I4DYL5	3e-64	A0A2I4DYL5_JUGRE; mini zinc finger protein 2-like
STRING	EOY03457	2e-46	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	6e-25	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]