PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00024372-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

CAMTA

Protein Properties

Length: 79aa MW: 9522.82 Da PI: 9.8085

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00024372-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	128.7	2.3e-40	11	79	36	104
CG-1 36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLee 104 gsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+een++fqrr+yw+Lee WALNUT_00024372-RA 11 GGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWMLEE 79 69*****************************************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	53.329	1	79	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	9.0E-28	1	79	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	6.8E-33	8	78	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MFTSHVFPIS GGSLFLFDRK VLRYFRKDGH NWRKKKDGKT VKEAHERLKA GSIDVLHCYY 60 AHGEENENFQ RRSYWMLEE

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM434540	2e-47	AM434540.2 Vitis vinifera contig VV78X210461.8, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008338581.2	6e-43	calmodulin-binding transcription activator 3 isoform X1
Refseq	XP_009393546.1	6e-43	PREDICTED: calmodulin-binding transcription activator 2
Refseq	XP_020421611.1	8e-43	calmodulin-binding transcription activator 3
Swissprot	Q6NPP4	1e-40	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	B9SZ48	8e-43	B9SZ48_RICCO; Calmodulin-binding transcription activator (Camta), plants, putative
STRING	XP_009338097.1	3e-42	(Pyrus x bretschneideri)
STRING	XP_008338581.1	3e-42	(Malus domestica)
STRING	EMJ09374	3e-42	(Prunus persica)
STRING	Pavir.J38535.1.p	5e-43	(Panicum virgatum)
STRING	XP_002531267.1	1e-43	(Ricinus communis)
STRING	Migut.L00133.1.p	1e-43	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF14241	18	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	4e-43	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]