PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00024310-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

NF-YB

Protein Properties

Length: 128aa MW: 14288.6 Da PI: 9.5804

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00024310-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	141.2	2.6e-44	8	82	2	76
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGf 76 ++qd+flPianvsrimk+ lP+nakisk+aketvqecvse+isfvt+easdkcqrekrktingddllwa+ tlG+ WALNUT_00024310-RA 8 KDQDKFLPIANVSRIMKRSLPTNAKISKEAKETVQECVSEYISFVTGEASDKCQREKRKTINGDDLLWAMMTLGL 82 79***********************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	7.6E-40	4	82	IPR009072	Histone-fold
SuperFamily	SSF47113	1.3E-29	10	85	IPR009072	Histone-fold
Pfam	PF00808	1.2E-26	13	77	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.2E-11	41	59	No hit	No description
PROSITE pattern	PS00685	0	44	60	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.2E-11	60	78	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MSDDSSSKDQ DKFLPIANVS RIMKRSLPTN AKISKEAKET VQECVSEYIS FVTGEASDKC 60 QREKRKTING DDLLWAMMTL GLCFLKIMET LTKKGRNKKV GLPRGDKPFA QYLAFAINGE 120 PINVSVVP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-35	8	82	2	76	Transcription factor HapC (Eurofung)
4g92_B	1e-35	8	82	2	76	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269\|PubMed:20566706, ECO:0000269\|PubMed:21148627}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269\|PubMed:26542958}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018835893.1	2e-51	PREDICTED: nuclear transcription factor Y subunit B-1-like
Swissprot	Q0J7P4	6e-45	HD5_ORYSJ; Nuclear transcription factor Y subunit B-11
TrEMBL	A0A2I4FW63	6e-50	A0A2I4FW63_JUGRE; nuclear transcription factor Y subunit B-1-like
STRING	XP_009342812.1	5e-46	(Pyrus x bretschneideri)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	3e-43	nuclear factor Y, subunit B3

Publications ? help Back to Top
Yan WH, et al. A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice. Mol Plant, 2011. 4(2): p. 319-30 [PMID:21148627] Dai X, et al. LHD1, an allele of DTH8/Ghd8, controls late heading date in common wild rice (Oryza rufipogon). J Integr Plant Biol, 2012. 54(10): p. 790-9 [PMID:22963226] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958]