PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00023956-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 208aa MW: 23872.9 Da PI: 7.0305 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.7 | 8.3e-11 | 27 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+ Tt E+ l + + +++ ++ Wk+Ia++++ gRt+k++ +wq ++ WALNUT_00023956-RA 27 KGSLTTKEQSLVISLQAKYDKK-WKKIAAEVP-GRTPKSLDKWWQVFK 72 6778******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 8.22E-11 | 12 | 81 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 6.8E-14 | 19 | 76 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.733 | 22 | 76 | IPR017930 | Myb domain |
SMART | SM00717 | 8.5E-8 | 26 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-8 | 27 | 70 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.41E-7 | 31 | 71 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MHAQYPPHAL TRFSDHAKNY LKPGLKKGSL TTKEQSLVIS LQAKYDKKWK KIAAEVPGRT 60 PKSLDKWWQV FKEKQLKQQQ QNQKKKNDNN APEYSDCTDV NIIPVVEFLE KAAQGPYDHI 120 LETFAEKYVL QLAQALHVPV PEWQYGSGAP MYFGARYGSH SVSRVDYVFF DDVDHASLMD 180 EHDLFPYDVF FYHLADAVSI SSSVPFSD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11076771, ECO:0000269|PubMed:11140682, ECO:0000269|PubMed:11882937, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269|PubMed:16166385, ECO:0000269|PubMed:21950734}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF059409 | 1e-47 | KF059409.1 Salvia miltiorrhiza MYB-related transcription factor (MYB55) mRNA, complete cds. | |||
GenBank | KF059519 | 1e-47 | KF059519.1 Salvia miltiorrhiza MYB-related transcription factor (MYB55) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018815417.1 | 3e-41 | PREDICTED: protein rough sheath 2 homolog | ||||
Swissprot | O80931 | 8e-27 | AS1_ARATH; Transcription factor AS1 | ||||
TrEMBL | A0A2I4E7P3 | 7e-40 | A0A2I4E7P3_JUGRE; protein rough sheath 2 homolog | ||||
STRING | XP_009349281.1 | 2e-39 | (Pyrus x bretschneideri) | ||||
STRING | XP_009371007.1 | 2e-39 | (Pyrus x bretschneideri) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37630.1 | 8e-25 | MYB family protein |