PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023956-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 208aa    MW: 23872.9 Da    PI: 7.0305
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023956-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.78.3e-112772148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+ Tt E+ l + + +++ ++ Wk+Ia++++ gRt+k++  +wq ++
  WALNUT_00023956-RA 27 KGSLTTKEQSLVISLQAKYDKK-WKKIAAEVP-GRTPKSLDKWWQVFK 72
                        6778******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-111281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-141976IPR009057Homeodomain-like
PROSITE profilePS5129418.7332276IPR017930Myb domain
SMARTSM007178.5E-82674IPR001005SANT/Myb domain
PfamPF002492.8E-82770IPR001005SANT/Myb domain
CDDcd001675.41E-73171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MHAQYPPHAL TRFSDHAKNY LKPGLKKGSL TTKEQSLVIS LQAKYDKKWK KIAAEVPGRT  60
PKSLDKWWQV FKEKQLKQQQ QNQKKKNDNN APEYSDCTDV NIIPVVEFLE KAAQGPYDHI  120
LETFAEKYVL QLAQALHVPV PEWQYGSGAP MYFGARYGSH SVSRVDYVFF DDVDHASLMD  180
EHDLFPYDVF FYHLADAVSI SSSVPFSD
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11076771, ECO:0000269|PubMed:11140682, ECO:0000269|PubMed:11882937, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269|PubMed:16166385, ECO:0000269|PubMed:21950734}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594091e-47KF059409.1 Salvia miltiorrhiza MYB-related transcription factor (MYB55) mRNA, complete cds.
GenBankKF0595191e-47KF059519.1 Salvia miltiorrhiza MYB-related transcription factor (MYB55) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018815417.13e-41PREDICTED: protein rough sheath 2 homolog
SwissprotO809318e-27AS1_ARATH; Transcription factor AS1
TrEMBLA0A2I4E7P37e-40A0A2I4E7P3_JUGRE; protein rough sheath 2 homolog
STRINGXP_009349281.12e-39(Pyrus x bretschneideri)
STRINGXP_009371007.12e-39(Pyrus x bretschneideri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.18e-25MYB family protein
Publications ? help Back to Top
  1. Hazen SP, et al.
    Rapid array mapping of circadian clock and developmental mutations in Arabidopsis.
    Plant Physiol., 2005. 138(2): p. 990-7
    [PMID:15908595]
  2. Pinon V, et al.
    Three PIGGYBACK genes that specifically influence leaf patterning encode ribosomal proteins.
    Development, 2008. 135(7): p. 1315-24
    [PMID:18305008]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Zhou F,Roy B,Dunlap JR,Enganti R,von Arnim AG
    Translational control of Arabidopsis meristem stability and organogenesis by the eukaryotic translation factor eIF3h.
    PLoS ONE, 2014. 9(4): p. e95396
    [PMID:24736281]
  5. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  6. Ivanova A, et al.
    A Functional Antagonistic Relationship between Auxin and Mitochondrial Retrograde Signaling Regulates Alternative Oxidase1a Expression in Arabidopsis.
    Plant Physiol., 2014. 165(3): p. 1233-1254
    [PMID:24820025]
  7. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  8. Kaurilind E,Xu E,Brosché M
    A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
    BMC Genomics, 2015. 16: p. 837
    [PMID:26493993]
  9. Mateo-Bonmatí E, et al.
    Plastid control of abaxial-adaxial patterning.
    Sci Rep, 2015. 5: p. 15975
    [PMID:26522839]
  10. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  11. Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J
    Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity.
    Plant Mol. Biol., 2016. 91(1-2): p. 37-51
    [PMID:26826012]
  12. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  13. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  14. Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ
    Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development.
    G3 (Bethesda), 2018. 8(4): p. 1379-1390
    [PMID:29487187]
  15. Tsukaya H,Uchimiya H
    Genetic analyses of the formation of the serrated margin of leaf blades in Arabidopsis: combination of a mutational analysis of leaf morphogenesis with the characterization of a specific marker gene expressed in hydathodes and stipules.
    Mol. Gen. Genet., 1997. 256(3): p. 231-8
    [PMID:9393447]