PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00023834-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 98aa MW: 11357.7 Da PI: 6.0797 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 57.1 | 5.1e-18 | 21 | 83 | 2 | 65 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65 F +kl ++++++e+++++sws+++nsfvv+++ efa k+Lpk+F h+n+aSF + n Y+F+++ WALNUT_00023834-RA 21 FFRKLCSMVDESETESMVSWSDDNNSFVVWNPYEFAAKLLPKHFNHKNLASFEHK-NPYEFTSI 83 899*************************************************876.99999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.1E-18 | 12 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 4.3E-7 | 17 | 96 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.0E-7 | 21 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 1.01E-16 | 21 | 85 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 7.8E-15 | 21 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.0E-7 | 59 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MANVNDAESS TTTTTDTLSL FFRKLCSMVD ESETESMVSW SDDNNSFVVW NPYEFAAKLL 60 PKHFNHKNLA SFEHKNPYEF TSIVALIKYF QQMHAPKR |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018829016.1 | 1e-32 | PREDICTED: heat stress transcription factor A-1b-like | ||||
Refseq | XP_018829017.1 | 1e-32 | PREDICTED: heat stress transcription factor A-1b-like | ||||
TrEMBL | A0A2I4FBJ6 | 3e-31 | A0A2I4FBJ6_JUGRE; heat stress transcription factor A-1b-like | ||||
STRING | Aquca_005_00532.1 | 9e-16 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32330.1 | 6e-16 | heat shock transcription factor A1D |