PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00021570-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 194aa MW: 21885.5 Da PI: 6.8583 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177 | 1.7e-55 | 34 | 130 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl+vyl++yr WALNUT_00021570-RA 34 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYR 124 69***************************************************************************************** PP NF-YB 92 elegek 97 e+eg++ WALNUT_00021570-RA 125 EMEGDR 130 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.0E-51 | 28 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.59E-39 | 37 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.4E-26 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.3E-17 | 68 | 86 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.3E-17 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 7.3E-17 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MERRKLTNIK IRPAPETNHI SNHSTTTDDS ECTVREQDRF MPIANVIRIM RKILPPHAKI 60 SDDAKETIQE CVSEYISFIT GEANERCQRE QRKTITAEDV LWAMSKLGFD DYIEPLTVYL 120 HRYREMEGDR GSMRGEPLGK RGVEFGTFGV AATFAPVFHM AGGHHQHGYF GGADHHMGGG 180 YLRDSTNAGS SGER |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-62 | 30 | 125 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018856401.1 | 1e-142 | PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X1 | ||||
Refseq | XP_018856402.1 | 1e-142 | PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X2 | ||||
Swissprot | Q84W66 | 3e-70 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A2I4HJQ8 | 1e-141 | A0A2I4HJQ8_JUGRE; nuclear transcription factor Y subunit B-6-like isoform X1 | ||||
TrEMBL | A0A2I4HJZ7 | 1e-141 | A0A2I4HJZ7_JUGRE; nuclear transcription factor Y subunit B-6-like isoform X2 | ||||
STRING | VIT_00s0956g00020.t01 | 8e-95 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 6e-73 | nuclear factor Y, subunit B6 |