PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00019528-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

NF-YB

Protein Properties

Length: 99aa MW: 10862.3 Da PI: 4.5703

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00019528-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	88.5	7.3e-28	25	73	1	49
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tse WALNUT_00019528-RA 25 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSE 73 69*********************************************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	5.0E-26	20	73	IPR009072	Histone-fold
SuperFamily	SSF47113	5.87E-17	21	73	IPR009072	Histone-fold
Pfam	PF00808	4.8E-17	31	73	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MADAPTSPNG GGSLESGEQS PRSNVREQDR FLPIANISRI MKKALPANGK IAKDAKETVQ 60 ECVSEFISFI TSEYEIDDLL FFNLLLVLFV SFGYNRCGG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-21	25	73	1	49	Transcription factor HapC (Eurofung)
4g92_B	1e-21	25	73	1	49	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018807843.1	1e-45	PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
Refseq	XP_018807844.1	1e-45	PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
Swissprot	Q8VYK4	1e-31	NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A2I4DL09	3e-44	A0A2I4DL09_JUGRE; nuclear transcription factor Y subunit B-1-like isoform X2
TrEMBL	A0A2I4DL24	2e-44	A0A2I4DL24_JUGRE; nuclear transcription factor Y subunit B-1-like isoform X1
STRING	XP_008442637.1	5e-41	(Cucumis melo)
STRING	XP_004137802.1	5e-41	(Cucumis sativus)
STRING	XP_004169107.1	2e-41	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF21273	4	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37060.3	9e-34	nuclear factor Y, subunit B8

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]