PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00018370-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 109aa MW: 11876.2 Da PI: 4.7403 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 50.5 | 5e-16 | 26 | 63 | 2 | 39 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecv 39 reqd fl ianv +imk +lPan+kiskdaketvqec+ WALNUT_00018370-RA 26 REQDPFLSIANVNQIMKTALPANGKISKDAKETVQECI 63 89***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.3E-8 | 10 | 63 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 2.8E-13 | 24 | 63 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-8 | 31 | 63 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MEDSDNESKG GSERAGNASA YELSPREQDP FLSIANVNQI MKTALPANGK ISKDAKETVQ 60 ECIWLVDGIR VVVKMKDFSG WERNLVGTLR SANEGEGSKA EKKNGFDPS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018838144.1 | 3e-75 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q75IZ7 | 5e-19 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2I4G2L3 | 7e-74 | A0A2I4G2L3_JUGRE; nuclear transcription factor Y subunit B-8-like | ||||
STRING | XP_007142418.1 | 9e-22 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-21 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|