PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00016968-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 187aa MW: 20916.4 Da PI: 8.0386 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 179.5 | 2.9e-56 | 38 | 134 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 ++eqdr+lPianv+rimkk+lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+atlGf+dy+eplk yl++yr WALNUT_00016968-RA 38 MKEQDRLLPIANVGRIMKKILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMATLGFDDYAEPLKRYLQRYR 128 589**************************************************************************************** PP NF-YB 92 elegek 97 elege+ WALNUT_00016968-RA 129 ELEGER 134 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.3E-56 | 33 | 153 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.73E-41 | 41 | 151 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.5E-28 | 44 | 108 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-20 | 72 | 90 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 75 | 91 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-20 | 91 | 109 | No hit | No description |
PRINTS | PR00615 | 1.5E-20 | 110 | 128 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MVDSTGGNNS DREGFKYHFA GTAPSVALGT DDDQDAAMKE QDRLLPIANV GRIMKKILPP 60 NAKISKEAKE TMQECVSEFI SFVTGEASDK CHKEKRKTVN GDDICWAMAT LGFDDYAEPL 120 KRYLQRYREL EGERSAQQSK PSSNEDQKNK TTNYGAAETT RKPTVPTTPS LKFNVIDRNN 180 SPVSRRF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-46 | 38 | 129 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-46 | 38 | 129 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018835425.1 | 1e-140 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O82248 | 1e-61 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2I4FUV6 | 1e-138 | A0A2I4FUV6_JUGRE; nuclear transcription factor Y subunit B-1-like | ||||
STRING | EMJ02876 | 3e-84 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-64 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|