PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00016377-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 71aa MW: 8365.75 Da PI: 10.4555 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.8 | 4.9e-08 | 35 | 65 | 2 | 32 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmg 32 +W++eEd++l+ ++k++G +W++ ++ g WALNUT_00016377-RA 35 ASWSPEEDQKLKAYIKRYGIWNWNRMPEASG 65 58*****************99***9888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.369 | 29 | 71 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-9 | 30 | 63 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.52E-7 | 31 | 63 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.64E-4 | 36 | 67 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
MVLRSLQVEI SGQYLEMMMM PKTSDGEKMP GRSRASWSPE EDQKLKAYIK RYGIWNWNRM 60 PEASGRKLIS R |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018808088.1 | 3e-35 | PREDICTED: myb-related protein Myb4-like, partial | ||||
TrEMBL | A0A2I4DLR3 | 6e-34 | A0A2I4DLR3_JUGRE; myb-related protein Myb4-like |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18570.1 | 9e-09 | myb domain protein 51 |