PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00011112-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 88aa MW: 10000.3 Da PI: 4.4086 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 58.9 | 1.4e-18 | 16 | 77 | 1 | 62 |
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 +Fl+kl +++++e+++++sws+++n+fvv+++ efa k+Lpk+Fkh+n+aSF+ L ++ F WALNUT_00011112-RA 16 SFLRKLDAMVDESETDSVVSWSDSNNNFVVWNPYEFAAKLLPKHFKHKNLASFTLTLVIFIF 77 59***************************************************988877665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 3.4E-20 | 8 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.9E-8 | 13 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 8.71E-18 | 14 | 84 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 3.1E-15 | 17 | 77 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.1E-9 | 17 | 40 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.1E-9 | 55 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MVDVNDAGSS TDTLPSFLRK LDAMVDESET DSVVSWSDSN NNFVVWNPYE FAAKLLPKHF 60 KHKNLASFTL TLVIFIFFVL TSFSNYLD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018829016.1 | 2e-33 | PREDICTED: heat stress transcription factor A-1b-like | ||||
Refseq | XP_018829017.1 | 2e-33 | PREDICTED: heat stress transcription factor A-1b-like | ||||
Swissprot | Q7XRX3 | 2e-17 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
TrEMBL | A0A2I4FBJ6 | 4e-32 | A0A2I4FBJ6_JUGRE; heat stress transcription factor A-1b-like | ||||
STRING | Aquca_005_00532.1 | 3e-18 | (Aquilegia coerulea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32330.1 | 2e-07 | heat shock transcription factor A1D |
Publications ? help Back to Top | |||
---|---|---|---|
|