PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00009253-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 172aa MW: 19397.2 Da PI: 10.0172 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32 | 2.8e-10 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g+WT+eEd +l+ +v+++G g+W++ ++ WALNUT_00009253-RA 14 KGPWTPEEDRILISYVQLYGHGNWRALPKQ 43 79***********************99886 PP | |||||||
2 | Myb_DNA-binding | 24.9 | 4.8e-08 | 62 | 83 | 24 | 46 |
HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 24 WktIartmgkgRtlkqcksrwqk 46 W++Ia++++ gRt++++k++w++ WALNUT_00009253-RA 62 WSAIAARLP-GRTDNEIKNFWNS 83 *********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.925 | 9 | 89 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.24E-15 | 10 | 81 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-14 | 13 | 87 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-23 | 13 | 90 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.2E-9 | 14 | 43 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.13E-12 | 16 | 82 | No hit | No description |
Pfam | PF00249 | 2.6E-6 | 62 | 84 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MAKAPCCENM GLKKGPWTPE EDRILISYVQ LYGHGNWRAL PKQAVSNIYL RFLMYVLSIA 60 LWSAIAARLP GRTDNEIKNF WNSQLKKRLK QNPATRPASI KQNNVGTPVC TLNTSTSNHA 120 SSTFPPQQSQ KVLGLQTDST NDPTKETMIN SSPFMSDEMD FWYKLFAKSG TH |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 84 | 90 | LKKRLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018820713.1 | 1e-107 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q7XBH4 | 3e-34 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | A0A2I4EMU3 | 1e-106 | A0A2I4EMU3_JUGRE; myb-related protein Myb4-like | ||||
STRING | EOY10933 | 8e-43 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 3e-36 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|