PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00008999-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 207aa MW: 23730.8 Da PI: 7.062 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.7 | 6.5e-19 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l ++++ +G ++W+t+a + g++R++k+c++rw++yl WALNUT_00008999-RA 15 KGAWTEEEDKKLSQYIEIHGAKRWTTVAIKAGLNRCGKSCRLRWLNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.9 | 1.5e-15 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l WALNUT_00008999-RA 68 RGNISDAEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113 788999****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.735 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.64E-29 | 14 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.5E-16 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-24 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.63E-11 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 25.506 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 5.4E-15 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.5E-14 | 68 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 70 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.06E-10 | 72 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MAPNNDGSAK KVMNKGAWTE EEDKKLSQYI EIHGAKRWTT VAIKAGLNRC GKSCRLRWLN 60 YLRPNIKRGN ISDAEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKINHK 120 EKAVEVTTTK ETMPQKLRDI VQGDIEDVKL EIGNSVGNFD ANEFFDFTAA DASHGLEWVN 180 KFLGSYSLES VDNFLELEED PWITENR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-29 | 13 | 117 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018819231.1 | 1e-152 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | P10290 | 2e-50 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A2I4EIK4 | 1e-151 | A0A2I4EIK4_JUGRE; transcription factor MYB114-like | ||||
STRING | XP_010053502.1 | 8e-92 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 3e-52 | myb domain protein 66 |