PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00003659-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

NAC

Protein Properties

Length: 65aa MW: 7616.82 Da PI: 4.5491

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00003659-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	61	3.8e-19	16	62	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdeelv +yLk+kve+ ++el evi+ vd+yk++Pw+Lp WALNUT_00003659-RA 16 LPPGFRFHPTDEELVGYYLKRKVERLEIEL-EVIPVVDLYKFDPWELP 62 79**************************.99************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.06E-19	11	62	IPR003441	NAC domain
PROSITE profile	PS51005	21.613	16	65	IPR003441	NAC domain
Pfam	PF02365	1.4E-9	17	55	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MQISVEERKN MAGASLPPGF RFHPTDEELV GYYLKRKVER LEIELEVIPV VDLYKFDPWE 60 LPVPT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-15	6	62	5	61	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269\|PubMed:21911380, ECO:0000269\|PubMed:25182467, ECO:0000269\|PubMed:27986917}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding in the flowering stem. {ECO:0000269\|PubMed:21911380}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018806244.1	5e-29	PREDICTED: NAC domain-containing protein 86-like
Swissprot	O49697	1e-26	NAC71_ARATH; NAC domain-containing protein 71
TrEMBL	A0A2G3C7N1	2e-27	A0A2G3C7N1_CAPCH; NAC domain-containing protein 45
TrEMBL	A0A2I4DGG8	1e-27	A0A2I4DGG8_JUGRE; NAC domain-containing protein 86-like
TrEMBL	I6YQY9	1e-27	I6YQY9_9CARY; NAC domain protein
STRING	XP_004511780.1	1e-27	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF11433	17	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17980.1	5e-29	NAC domain containing protein 71

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Asahina M,Satoh S Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues. J. Plant Res., 2015. 128(3): p. 381-8 [PMID:25736731] Matsuoka K, et al. Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls. Plant Cell Physiol., 2016. 57(12): p. 2620-2631 [PMID:27986917]