PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S20011.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 100aa MW: 11914.2 Da PI: 11.1844 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.5 | 2.6e-12 | 43 | 87 | 3 | 47 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 + ++e++k+kNR +A rsRq+K ++++ ee v+eL +eN+++ Jcr4S20011.10 43 QMRKEKKKIKNRASAARSRQKKIEKTKFMEEQVDELRKENTQMER 87 679*************************************99874 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 9.3E-11 | 39 | 90 | No hit | No description |
SMART | SM00338 | 1.6E-5 | 41 | 100 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 9.5E-10 | 42 | 87 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.772 | 43 | 92 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.69E-10 | 44 | 92 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 48 | 63 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
LLVMAMLNSF GSGVRISQEW LQVDMLLVRG RRKRIIEGSE QDQMRKEKKK IKNRASAARS 60 RQKKIEKTKF MEEQVDELRK ENTQMERLIK LMVITTFFLI |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012077862.1 | 2e-56 | ABSCISIC ACID-INSENSITIVE 5-like protein 7 | ||||
TrEMBL | A0A067KMU9 | 4e-55 | A0A067KMU9_JATCU; Uncharacterized protein | ||||
STRING | XP_002537820.1 | 2e-24 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF27059 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G36270.1 | 2e-09 | bZIP family protein |