PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S12729.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 166aa MW: 18880.3 Da PI: 9.7794 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.7 | 7.9e-33 | 70 | 126 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k+ +ksrkpylheSRh+hAlrR+Rg gGrF Jcr4S12729.20 70 EEPVFVNAKQYHGILRRRQSRAKAESENKV-IKSRKPYLHESRHQHALRRARGLGGRF 126 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 8.6E-37 | 68 | 129 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.818 | 69 | 129 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 7.7E-28 | 71 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 7.7E-24 | 72 | 94 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 74 | 94 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 7.7E-24 | 103 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MQNTMCITWT PFYLKAAAAY PYPDPYYRSI FAPYDAQPYP PQPYGGQPMV HLQLMGIQQA 60 GVPLPTDAVE EPVFVNAKQY HGILRRRQSR AKAESENKVI KSRKPYLHES RHQHALRRAR 120 GLGGRFLNSK KNENREQKEV ASGDKSQSNI NLNCDKNDIA SSDSQC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-22 | 69 | 134 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC182693 | 2e-46 | AC182693.2 Populus trichocarpa clone Pop1-44N6, complete sequence. | |||
GenBank | AC187864 | 2e-46 | AC187864.2 Populus trichocarpa clone Pop1-32E3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012075625.1 | 1e-110 | nuclear transcription factor Y subunit A-7 isoform X4 | ||||
Refseq | XP_012075626.1 | 1e-110 | nuclear transcription factor Y subunit A-7 isoform X4 | ||||
Swissprot | Q84JP1 | 1e-61 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A067KSV9 | 1e-108 | A0A067KSV9_JATCU; Uncharacterized protein | ||||
STRING | XP_002523193.1 | 1e-96 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5379 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-42 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|