PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S07775.10 | ||||||||
Common Name | JCGZ_08592, LOC105635555 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 95aa MW: 10269.7 Da PI: 6.498 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 43.7 | 8.1e-14 | 1 | 40 | 61 | 100 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal+++e Jcr4S07775.10 1 MVYEANARVRDPVYGCVGAISSLQQQIDALQTQLALAQAE 40 69*********************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 2.9E-11 | 1 | 38 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 9.627 | 1 | 41 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MVYEANARVR DPVYGCVGAI SSLQQQIDAL QTQLALAQAE VVHLRVRQTA ISTHGLSPAS 60 PTNSGSPSSR LIGQVKPIFD MDMVDQASLG EMWRC |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012074020.1 | 4e-64 | LOB domain-containing protein 4 | ||||
Swissprot | Q9SHE9 | 2e-24 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A067KK06 | 1e-62 | A0A067KK06_JATCU; Uncharacterized protein | ||||
STRING | Gorai.011G051200.1 | 3e-48 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1334 | 34 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 2e-20 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105635555 |
Publications ? help Back to Top | |||
---|---|---|---|
|