PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Jcr4S06820.20 | ||||||||
Common Name | JCGZ_05961, LOC105634574 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 230aa MW: 27171.1 Da PI: 7.5794 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 82.9 | 2e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRr+g+lKK +ELSvLC+a++ +iifsstgkl y++ Jcr4S06820.20 9 KRIENQTTRQVTFSKRRAGLLKKTHELSVLCEAQIGLIIFSSTGKLCQYCT 59 79***********************************************96 PP | |||||||
2 | K-box | 75 | 2.1e-25 | 71 | 168 | 1 | 97 |
K-box 1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 yqk +g++ e+ e+l+ ela L+ke++ Lq + R++ Ged++s+ +++L +LeqqLe s+ kiRs+Knell +q+++l +k ++l+een ++ Jcr4S06820.20 71 YQKLTGTKiPEDDRRENLYDELAMLRKETRRLQLNMRRYTGEDMSSIPFEDLDELEQQLEYSVAKIRSRKNELLQQQLDNLHRKVRMLEEENGNIY 166 788889998899999*****************************************************************************9887 PP K-box 96 kk 97 + Jcr4S06820.20 167 RW 168 65 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.73 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.03E-40 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 2.62E-30 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 7.6E-24 | 81 | 169 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.569 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MGRGKIPIKR IENQTTRQVT FSKRRAGLLK KTHELSVLCE AQIGLIIFSS TGKLCQYCTE 60 PFRMEQIIER YQKLTGTKIP EDDRRENLYD ELAMLRKETR RLQLNMRRYT GEDMSSIPFE 120 DLDELEQQLE YSVAKIRSRK NELLQQQLDN LHRKVRMLEE ENGNIYRWIQ DHRVAMEYQQ 180 ATIEAKPVEH QHVLDQFPFC GEPSSVLQLA TIPSQIHSYH LQLAQPNLQE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_B | 3e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_C | 3e-18 | 1 | 71 | 1 | 69 | MEF2C |
5f28_D | 3e-18 | 1 | 71 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC216682 | 2e-40 | AC216682.1 Populus trichocarpa clone POP024-L07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020535116.1 | 1e-170 | protein TRANSPARENT TESTA 16 | ||||
Swissprot | Q8RYD9 | 8e-91 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A067KN08 | 1e-168 | A0A067KN08_JATCU; Uncharacterized protein | ||||
STRING | EOX99096 | 1e-144 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4935 | 29 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 6e-87 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 105634574 |